SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003760630.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003760630.1.9362
Domain Number 1 Region: 236-379
Classification Level Classification E-value
Superfamily PH domain-like 2.87e-47
Family Phosphotyrosine-binding domain (PTB) 0.00000198
Further Details:      
 
Domain Number 2 Region: 407-513
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-18
Family PDZ domain 0.00014
Further Details:      
 
Domain Number 3 Region: 507-590
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-16
Family PDZ domain 0.0000917
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003760630.1.9362
Sequence length 598
Comment PREDICTED: amyloid beta A4 precursor protein-binding family A member 3 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MDSGVSSSGPPAMDLEQSEASNPLPFGPPPPAATPSEPHCPWDLAVPEAAPTSDLEGTGP
EAVGSQNQMDLDEDPSGQELQDLVGQFQALPLDLPEAPSQNGHPCPLHIATGHGLTTPEA
SENHGLLSSEARHEDLINLLCGEEGAPLTQTAPPSPEGPQGPVPCLLQPPKDCAERTEEG
SVDGEGSSSSSPEPWLGPGPLVHSEDLSADVGATQNSEALASYPTFQEVAGPCDPEDLLD
GVIFGAKYLGSTQLVSERNPSLSARMAQAQEAVDRIKAPEGETQPMTEVDLFISTKRIKV
LTADSQEAMMDHSLQTISYIADIGNVVVLMARRRLARQPGSQERRLYKMICHVFHSADAQ
LIAQAIGQAFGVAYGQFLRASGIDPSQLSTQDHGRPKEGDLHNGDLAHFSNQENCRDVCI
EKQRGECLGVALVESGWGSLLPTAVIANLLHGGPAERSGLLSIGDRLTAVNGTSLVGLPL
ASCQAIVRELKSETSVTLSIVHCPPVTTAIIRRPHAREQLGFCVENGIICSLMRGGIAER
GGVRVGHRIIEINGQSVVATPHDRIIQLLTQAHDEVHIKMMPASTYRLLTGQEQPVYL
Download sequence
Identical sequences G3VH57
XP_003760630.1.9362 ENSSHAP00000002511 ENSSHAP00000002511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]