SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003762434.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003762434.1.9362
Domain Number 1 Region: 13-255
Classification Level Classification E-value
Superfamily SET domain 8.5e-65
Family Histone lysine methyltransferases 0.000085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003762434.1.9362
Sequence length 299
Comment PREDICTED: histone-lysine N-methyltransferase SETMAR [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MSEEQPGASLGGQRDVGRGLENLPVSSWPEGEEPEFQYTPEHVIGPGAEVDPTQITFPGC
TCLTTSCLPTICSCLLHGENYDNLCLRDIEGKMEFARPVFECNVMCQCSEQCKNRVVQRG
LQFNLQVFKTDKKGWGLRTLEFIPKGRFVCEYAGEILGSSEARRRIQQQTKHDSNYIIAI
REHICDGQIIETFVDPTNIGNIGRFLNHSCEPNLLMIPVRVDSMVPRLALFAAKDILPKE
ELSYDYSGRFRNFTKNDRNQEIPDKDKMGKPCYCATKSCAAFLPYDSSLYSPLEKQTTN
Download sequence
Identical sequences G3WBD8
ENSSHAP00000012743 XP_003762434.1.9362 ENSSHAP00000012743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]