SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003762511.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003762511.1.9362
Domain Number 1 Region: 217-230,380-617
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-63
Family Nuclear receptor ligand-binding domain 0.0000628
Further Details:      
 
Domain Number 2 Region: 147-230
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.76e-32
Family Nuclear receptor 0.0000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003762511.1.9362
Sequence length 629
Comment PREDICTED: nuclear receptor subfamily 2 group C member 2 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MATNMEVLAQQIVETQQVAEVQTVQTSLSESPVMTSPSQRIQIISTDSSVASPQRIQIVT
DQQTGQKIQIVTAVDSSVSPKQQFILTSPDGTGTGKVILASPETSSAKQLIFTTTDNLVP
GRIQIVTDSASVERLLGKADVQRPQVVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRK
NLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPTNCAAS
TEKIYIRKDLRSPLIATPTFVADKDGTRQTGLLDPGMLVNIQQPLIRDDGTVLLAADSKA
ETSQGALGTLANVVTSLANLNESLNNGDPSEIQQEDQSASEITRAFDTLAKALNTTDGSS
PPNLADGMDPTGGGNIHVISRDQSTPIIEVEGPLLTDTHVTFKLTMPSPMPEYLNVHYIC
ESASRLLFLSMHWARSIPAFQALGQDCNTSLVRACWNELFTLGLAQCSQVMSLSTILAAI
VNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSMAKLDIDGYEYAYLKAIVLFSPDHPG
LTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSSSITEELFFTGLI
GNVSIDSIIPYILKMETAEYNGQITGTNL
Download sequence
Identical sequences G3WU35
ENSSHAP00000018940 XP_003762511.1.9362 ENSSHAP00000018940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]