SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003762609.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003762609.1.9362
Domain Number 1 Region: 19-125
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.51e-33
Family MBT repeat 0.00042
Further Details:      
 
Domain Number 2 Region: 274-396
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.05e-29
Family MBT repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 380-455,483-519
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.69e-25
Family MBT repeat 0.002
Further Details:      
 
Domain Number 4 Region: 155-269
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.15e-23
Family MBT repeat 0.00018
Further Details:      
 
Domain Number 5 Region: 791-862
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.45e-17
Family SAM (sterile alpha motif) domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003762609.1.9362
Sequence length 867
Comment PREDICTED: scm-like with four MBT domains protein 1 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MNGEQQFDTDAGSGVEEVEFNWDEYLEDTGSIAAPHGSFKHVDTSLQNGFAPGMKLEVAV
KSDHETYWVATIITTCGQLLLLRYDGYGEDRKADFWCDIRTADLHPIGWCEQNKKILKAP
EGIKDKISDCYEFLRETLKGAYSAPSNLLEGLHKGKNPLDLIAPGSRLECQNFQDSLSTW
IVNVADNIGGRLKLHYEGLENSDQFEQWLFYLDPFLHQVGWASQEGYALHPPTVIRHLKS
EAEWQEILTKIKEEEEESLIPSDLFKDKLVIGHHTFSVGMKLEALDPSAPFTISPATIVK
VFNEKYFLVEIDDLRAENTTRRSFVCHVNSSGIFPVHWSLKNGLHLSPPPGYPNQDFDWA
DYLKQCGAEAAPQSCFPLPISDHGFKENMKLEAVNPIDPEEVCVATITAVKGSYLWLQLE
GSKKPVPECIVSVESMNIFPVSWCETNGYQLRSPRRAVVNKQKKVAVVQPEKQIIPSRMV
HESLKNQEPNPPDSVTINGKYFCPKIYFNHRCFSGPYLNKGRIAELPQCVGPGNCVLVLK
EVLTLLINAAYKPSRVLRELQLDEDSVWHGHGETLKAKYKGKSYRATVEIVRTADRVTDF
CRKTCIKLECCPNLFGPQMVLDKCSENCSVLTKTKYTHYYGKKKNKRIGRPPGGHSNLEC
VMKKTNKRRKRRKNFFVHKKKRSSTSVDNTPAGSPQGSGCEDDDDQDEVDEESLSEDSAS
EQQDELQEESEVSEKKSCSSSPTQSELSHSLAQERDKRKRKLRTFSFSDDENKPPSPKEI
KIEVAEKLQLDSNPLEWSVADVVRFIKSTDCAPLARIFLDQEIDGQALLLLTLPTVQECM
DLKLGPAIKLCHHIERIKFAFYQQFAN
Download sequence
Identical sequences G3VNX6
ENSSHAP00000004881 XP_003762609.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]