SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003764103.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003764103.1.9362
Domain Number 1 Region: 69-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 1.52e-16
Family Ovomucoid domain III-like 0.0052
Further Details:      
 
Domain Number 2 Region: 164-228
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000277
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 3 Region: 261-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000449
Family EGF-type module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003764103.1.9362
Sequence length 374
Comment PREDICTED: tomoregulin-2 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MVLWESPRQCSSWTLCDGFCWLLLLPVMLLIIARPVKLAAFPTSLSDCQTPTGWNCSGYD
DRENDLFLCDTNTCKFDGECLRIGDSVTCVCQFKCNSDYVPVCGSNGDTYQNECYLRQAA
CKQQSEILVASEGSCAADAGSGSGDGVNEGSGETSQKETSTCDICQFGAECDEDAEDVWC
VCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDG
HYARTDFAENPNKLEESARGLYIPCPEHYNGFCLHGKCEHSINMLEPSCRCDAGYTGQHC
EKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAIICVVVLCITRKCPRSNRIHRQKQNTGH
YSSDNTTRASTRLI
Download sequence
Identical sequences G3X2I7
XP_003764103.1.9362 ENSSHAP00000021892 ENSSHAP00000021892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]