SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003767548.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003767548.1.9362
Domain Number 1 Region: 54-182
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.31e-46
Family Regulator of G-protein signaling, RGS 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003767548.1.9362
Sequence length 198
Comment PREDICTED: regulator of G-protein signaling 16 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MCRTLSAFPSTCLERAKEFKTRLGIFLHKSELGTESGNVSKFEWGSKQSKEKFVPEDVLG
WKESFDHLLSSKSGIAAFRAFLKTEFSEENLEFWLACEEFKKIQSTSKLASRAQRIFDEF
ICSEAPKEVNIDHETRELTQKNLQGATTTCFDEAQGKTRTLMEKDSYPRFLRSAAYRDLV
EQACVASTSQSGGQCSHT
Download sequence
Identical sequences G3VQY0
ENSSHAP00000005585 XP_003767548.1.9362 ENSSHAP00000005585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]