SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003767578.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003767578.1.9362
Domain Number 1 Region: 75-204
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.09e-45
Family Regulator of G-protein signaling, RGS 0.00000074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003767578.1.9362
Sequence length 236
Comment PREDICTED: regulator of G-protein signaling 18 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MEKPLVFFSQLTMSDSKEKNFYKVIHAIGKEALNKDIKNRNKEKRNRLSLLLQKPEFHEN
VNLGGSSENLAKGTSVSPEEAVKWSESFDKLLSHKDGFDAFTRFLKTEFSEENIEFWAAC
EDFKKSQEPHQLFHKAQAIYEKFIQNDAPQEVNLDFHTKETIFKSISQPTIHSFDAAQSR
VYRLMEQDSYTRFLRSDIYLDLINGRPLRTTNLRRRSRSFTFNEFPAEKSDIAIWL
Download sequence
Identical sequences G3VWF5
ENSSHAP00000007510 ENSSHAP00000007510 XP_003767578.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]