SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003772888.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003772888.1.9362
Domain Number 1 Region: 54-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000238
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003772888.1.9362
Sequence length 147
Comment PREDICTED: epigen isoform X2 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MALGIPLYILLNAMVSLSKEAAVTVTTPITSQQSNWTVNKTEAEYTEGPIALKFSHPCLA
DHHSYCINGVCAFHHELRKAICRCTTGYTGERCEHLTLTSYAVDSYEKYIAVGIGVGLLL
SLFLAIIYCYVRKRYGSRRNMAWTALH
Download sequence
Identical sequences G3WW74
XP_003772888.1.9362 ENSSHAP00000019679 ENSSHAP00000019679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]