SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003774426.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003774426.1.9362
Domain Number 1 Region: 113-246
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000105
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 215-333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 43-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000711
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003774426.1.9362
Sequence length 447
Comment PREDICTED: EGF-containing fibulin-like extracellular matrix protein 2 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MLPLVSFLRGQLLLLLLLGTASPQDPEEPDSYMECTDGYEWDAESQHCKDVNECETIPDA
CKGEMKCINHYGGYLCLPRSAAVINDVHSEGGPPPRPRPPRPPAPGPPRPNPCPQGYEPD
DQDNCVDIDECDLDLHDCRPSQECHNLPGSFHCSCPDGYRKMGSECVDIDECRYRYCQHR
CVNVPGSFTCQCEPGFQLGPNNRSCVDVNECEMGAPCEQRCFNSYGTFLCRCNQGYELHR
DGFSCNDIDECRHSTYLCQYHCSNEPGRFSCHCPQGYQLLGTRLCQDIDECETGTHQCSE
GQSCVNFHGGYRCVETNRCSEPYVQVSDNRCLCPASDPRCREQPSSIVHRYMSITSERSV
PADVFQIQATSVYPGAYNAFQIRAGNPQGDFYIRQINNISAMLVLARPVTGPREYVLDLE
MVTMNSLMSYRASSVLRLTVFVGAYAF
Download sequence
Identical sequences G3VF06
XP_003774426.1.9362 ENSSHAP00000001760 ENSSHAP00000001760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]