SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003774868.1.9362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003774868.1.9362
Domain Number 1 Region: 158-542
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.03e-155
Family Myotubularin-like phosphatases 0.0000000000369
Further Details:      
 
Domain Number 2 Region: 34-155
Classification Level Classification E-value
Superfamily PH domain-like 2.4e-41
Family GRAM domain 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003774868.1.9362
Sequence length 603
Comment PREDICTED: myotubularin isoform X1 [Sarcophilus harrisii]; AA=GCF_000189315.1; RF=representative genome; TAX=9305; STAX=9305; NAME=Sarcophilus harrisii; AL=Scaffold; RT=Major
Sequence
MASASTPKYNSRSLENDSIRRSSRDGFTRDLCEEIPRLPGETRITDKEVIYICPFNGPIK
GRVYITNYRLYLRSLETDSGALLDIPLGVIARVEKMGGASSRGENSYGLDITCKDMRNLR
FALKQEGHSRRDIFEILTKYAFPRSHGLPLFAFLNEEKFPENGWMVYNPIEEYRRQGLPN
GQWRVSFVNKRFEMCETYPSILVVPYHSTDDDLRRVATFRSRNRIPVLSWIHPENKNVIM
RCSQPLVGMGGKRNKDDEKYLDIIREANGQISKLAIFDARPSVNAVANKATGGGYESDDV
YHNAEIFFLDIHNIHVMRESLRKLKDIVYPNVEESHWLSSLESTHWLEHVKFVLTGAIQV
ADKVASGRSSVLVHCSDGWDRTAQLTSLAMLMLDSYYRTITGFEVLIQKEWISFGHKFAS
RIGHGEKNYADTDRSPIFLQFMDCVWQMSKQFPTAFEFNEQFLVTILDNLYSCRFGTFLF
NSEYAREKEKVMMKTLSLWSMINSDKRKYTNPFYTKELNRALYPVASMRHLELWVNYYIR
WNTRMRQQQPNPVEQRYMELLALRDEYVKRLEEMKMTNSAKLPGSSASSSATSQMMPHVQ
TPF
Download sequence
Identical sequences G3WVR9
ENSSHAP00000019524 ENSSHAP00000019524 XP_003774868.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]