SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003777858.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003777858.1.23681
Domain Number 1 Region: 271-664
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000091
Family Hermes transposase-like 0.03
Further Details:      
 
Weak hits

Sequence:  XP_003777858.1.23681
Domain Number - Region: 121-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0476
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003777858.1.23681
Sequence length 693
Comment PREDICTED: zinc finger BED domain-containing protein 5 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MIAPLLCILSYNFNTFAILNVYSKLTMFCTTNSLPMDLLLKQGSLKQEVESFCYQIVSES
NDQKVGILQSEDKQLQPSVSKKSEGELSRVKFISNSNKITFSKKPKRRKYDESYLSFGFT
YFGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKP
PTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDA
VQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVRYRFNKS
IEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAVDGKIAEAVTLI
KYVAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMG
AQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFMDSAFRLSDCLTNSSWLLRLAYLADI
FTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINST
VDKDICSAIVQHLRGLHSTLLKYFPVTNDNNAWVRNPFTVTVKPASLVARDYESLIDLTS
DSQVKQNFSELSLNDFWSSLIQEYPSIARRAVRVLLPFATMHLCETGFSYYAATKTKYRK
RLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH
Download sequence
Identical sequences H2NE35
ENSPPYP00000003999 XP_002822075.1.23681 XP_003777858.1.23681 XP_009244894.1.23681 9600.ENSPPYP00000003999 ENSPPYP00000003999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]