SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003785297.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003785297.1.62490
Domain Number 1 Region: 370-633
Classification Level Classification E-value
Superfamily L domain-like 7.31e-42
Family Ngr ectodomain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 667-815
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.03e-37
Family Toll/Interleukin receptor TIR domain 0.0000532
Further Details:      
 
Domain Number 3 Region: 26-243,303-328
Classification Level Classification E-value
Superfamily L domain-like 1.02e-32
Family Ngr ectodomain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003785297.1.62490
Sequence length 832
Comment PREDICTED: toll-like receptor 4 isoform X1 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MMFFSRLAGALIPAMAFLSCLRPESWEPCVEVVPNITYQCMELNLYKIPDNIPSSTKNLD
LSFNPLGHLGSHSFYSFSELQVLDLSRCEIQAIEENAFQNLNHLSTLILTGNPLRSLALG
AFSGLPSLQKLVAVETNLASLEDLPIGHLESLKELNVAHNLIHSFKLPEYFSNLLNLERL
DLSNNHIQNISHKDLQVLHRVPSRNLSLDLSLNPIDFIQPGSFKGIRLRELTLRSNFDSL
SVMKTCIQNLAGLEVHRLVLGEFKNERYIKDIDQSALEGLCNLTIEEFRLAYLDDSLQGA
ELLHCLENVSAISLVSLDLSHLKSLCNNFKWKSLELIDCKFEQFPILELFSLKRFIFTAN
RGGNTFIKVKLPDLEYLDLSKNGLSYTGCCSHTDLGTTRLTHLDMSFNGIITMTSNFLGL
EQLKHLDFQHSSLKQMSDFSVFLPLRNLLYLDLSYTHTQVAFHGIFDGLVSLQVLKMAGN
SFQDNILPDVFKEMTNLTFLDLSDCQLEQVSQKAFNTLSRLQLLNMSHNNLVSLDVLPYK
PLQSLQVLDFSFNRIVALRKQELQDFPRSLAFLNLTQNEFVCVCEHQSFLQWVKDQRQLL
VKAENMVCAMPLDMKGMSVLSFRNTTCQMNKTVISVSVVIVLMVSVVVVLVYKFYFHLML
LAGCKKYGTGESTYDAFVIYSSQDEDWVRNELVKNLEEGVPHFQLCLHYRDFIPGVAIAA
NIIQEGFHKSRKVIVVVSKHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKSLLR
QQVDLYCLLNRNTYLEWEDNALGRHIFWRRLRKALLDGKPWSPEAAAGEECN
Download sequence
Identical sequences XP_003785297.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]