SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003785800.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003785800.1.62490
Domain Number 1 Region: 53-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.23e-45
Family Regulator of G-protein signaling, RGS 0.00000879
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003785800.1.62490
Sequence length 181
Comment PREDICTED: regulator of G-protein signaling 5 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSAVDLVIPYNEKPEKPAKAQKPSPDEALQ
WRDCLDKVLQNDYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEF
IQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDVAQKRIHALMEKDSLPRFVRSEFYQELI
K
Download sequence
Identical sequences H0X7G9
XP_003785800.1.62490 ENSOGAP00000011356 ENSOGAP00000011356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]