SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003787844.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003787844.1.62490
Domain Number 1 Region: 78-206
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.14e-44
Family Regulator of G-protein signaling, RGS 0.000000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003787844.1.62490
Sequence length 217
Comment PREDICTED: regulator of G-protein signaling 19 isoform X1 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MPTPHEAEKQHTGPEEADRPPSMTSHDVAPQVAPGRNPCCLCWCCCCSCSWNEERRRVWQ
ASRESKLQPLPGCEVCATPSHEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFW
LACEDLKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDA
QLQIYTLMHRDSYPRFLSSPTYRALLLRGASQSSSES
Download sequence
Identical sequences H0XHV1
ENSOGAP00000015691 XP_003787844.1.62490 ENSOGAP00000015691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]