SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003788007.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003788007.1.62490
Domain Number 1 Region: 37-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-35
Family Galectin (animal S-lectin) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003788007.1.62490
Sequence length 172
Comment PREDICTED: galectin-related protein [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIV
DLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIP
DQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
Download sequence
Identical sequences A0A096P062 A0A0D9RQE5 A0A1U7SX44 A0A2J8XC49 A0A2K5ETC7 A0A2K5LE49 A0A2K6LAT9 G3QU51 H0WXA6 K6ZZC6 Q3ZCW2 Q5R5K6
ENSGGOP00000006243 ENSOGAP00000007073 ENSOGAP00000007073 9600.ENSPPYP00000013789 9606.ENSP00000238875 ENSP00000238875 NP_001126745.1.23681 NP_054900.2.87134 NP_054900.2.92137 XP_003788007.1.62490 XP_004029368.1.27298 XP_007968639.1.81039 XP_008050070.1.4292 XP_011894991.1.92194 XP_012332653.1.9421 XP_016804123.1.37143 XP_017745545.1.44346 ENSGGOP00000006243 ENSP00000238875 gi|156151366|ref|NP_054900.2| ENSPPYP00000013789 GO.46337 NYSGRC-LECT-ENSP00000238875 ENSP00000238875 ENSPANP00000018737 ENSPPYP00000013789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]