SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003788448.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003788448.1.62490
Domain Number 1 Region: 49-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-32
Family Spermadhesin, CUB domain 0.00018
Further Details:      
 
Domain Number 2 Region: 169-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-19
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 
Domain Number 3 Region: 291-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003788448.1.62490
Sequence length 533
Comment PREDICTED: neuropilin and tolloid-like protein 1 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MIYGRSLFHIVASLIIIHLSGATKKGTEKQTPSETQKSVQCGTWTKHADGGIFTSPNYPS
KYPPDRECVYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQ
QNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGVLKPLPACEFEMGGPE
GIVESMQIMKEGKASASEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCH
SNMCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCIVIILIIIS
VIVQIKQPRKKYVQRKADFDQTVFQEVFEPPHYELCTLRGTGATADFADVAEDFENYHKL
RRSSSKCIHDHHCGSQLSSTKGSRSNLSTRDASILTEMPPQPVKPLIPPMNRRNILVMKH
NYSQDAADACDIDEIEEVPTTSHRLSRHEKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences H0X1H1
ENSOGAP00000008839 ENSOGAP00000008839 XP_003788448.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]