SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003789117.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003789117.1.62490
Domain Number 1 Region: 13-217
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.95e-55
Family Proteasome subunits 0.000000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003789117.1.62490
Sequence length 219
Comment PREDICTED: proteasome subunit beta type-9 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MLRAGAPTGDLPWAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHQR
IYCALSGSAADAQAVADMAAYQLELHGLELEEAPLVLAAATVVRNITYKYREDLSAHLMV
AGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTYIYGYVDAAYKPGMSPEECRRFTTDAIA
LAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDD
Download sequence
Identical sequences H0X9X9
ENSOGAP00000012399 ENSOGAP00000012399 XP_003789117.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]