SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003789280.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003789280.1.62490
Domain Number 1 Region: 226-471
Classification Level Classification E-value
Superfamily RNI-like 3.4e-44
Family 28-residue LRR 0.011
Further Details:      
 
Weak hits

Sequence:  XP_003789280.1.62490
Domain Number - Region: 90-155
Classification Level Classification E-value
Superfamily F-box domain 0.000589
Family F-box domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003789280.1.62490
Sequence length 497
Comment PREDICTED: T-complex-associated testis-expressed protein 1 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MQDTVTTPQPSAVSRPSLSTQDKTSTGITGSQPWKPMVTPASVKSKPPTSGNSFYRMRRI
IAEDPEWSLAIVPLLTELCIQHIVRNFQNNPILKQLLPEHQQKVLSRLSPDLPLTVTANL
IDDEGYWRRCCTQRWPVCYVAQHGGSWKHMFFERHLENLLKHFIPGTTDPAVILDMVPLC
RNYVRRLHVDQFLPPVRLPSPPRAVDQSDSGSEGEVEESTTDHYQLGDLVAGLSYLEELD
LVYGVKDCGMNFEWNLFLFTYRDCHSLAATIKACLTLKIFRLTRSKVDDDKARILIRSLL
DHPVLEELDLSHNLIGDRGARGAAKLLSHSRLRVLNLANNQVRAPGAQSLAHALAHNTSL
ISLNLRLNCIEDEGGQALAHALHTNKCLTTLHLGGNELSEPTATLLAQVLSTNTTLTSIN
LSCNHIGLDGGKQLLEGMSDNKTLLEFDLRLSDVAQESEYLIGQALNANREAARQRALNP
IQFMSPITADGPENSAG
Download sequence
Identical sequences H0XSC5
ENSOGAP00000019017 XP_003789280.1.62490 ENSOGAP00000019017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]