SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003791112.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003791112.1.62490
Domain Number 1 Region: 112-172,292-375
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.75e-33
Family Regulator of G-protein signaling, RGS 0.0076
Further Details:      
 
Domain Number 2 Region: 370-509
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.12e-28
Family Regulator of G-protein signaling, RGS 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003791112.1.62490
Sequence length 661
Comment PREDICTED: A-kinase anchor protein 10, mitochondrial [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDGKSIRASVSVHSPQKSTKNH
ALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEAAHFGDLGRSCLDYQTQETKS
SLSKTLEQVLHDTVVLPYFIQFMELRRMEHLVKFWLEAESFHSTTWSRIRAHTLNTVKQS
SLAEPVSPSKKHESTASFVTESLDKRLEDSSSAQLLMTQSEGIDLNNRTNSTQNHLLLSQ
ECGSAHSLHLQMARAGTHQVSMETQESSRFIVANRNNPSSPLKDLSGKLMKSIEQDAVNT
FTKYISPDAAKPIPITEAMRNDIIAKICGEDGQVDPNCFVLAQSIVFSAMEQEHFSEFLR
SHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLAA
KKGQYDGQEAQSDAMILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPLR
QAWTTMEKVFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNISLAAHGSVGPPDEANAGGS
DSSTSQSSVKKASIKILKNFDEVIIVDAASLDPESLYQRTYAGKMTFGRVSDLGQFIRES
EPEPDVKKSKGSMFSQAMKKWVQGSTDEAQEELAWKIAKMIVSDVMQQAQCDQPVERSTK
L
Download sequence
Identical sequences H0WYD5
ENSOGAP00000007517 ENSOGAP00000007517 XP_003791112.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]