SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003794754.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003794754.1.62490
Domain Number 1 Region: 290-386
Classification Level Classification E-value
Superfamily Immunoglobulin 7.13e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 449-740
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 5.1e-16
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.035
Further Details:      
 
Domain Number 3 Region: 37-88
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000305
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 4 Region: 210-302
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000155
Family I set domains 0.082
Further Details:      
 
Domain Number 5 Region: 132-205
Classification Level Classification E-value
Superfamily EF-hand 0.00000000223
Family Calmodulin-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003794754.1.62490
Sequence length 802
Comment PREDICTED: follistatin-related protein 5 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MKCISDFNWFLIQDDPFGSCENKYCGLGRHCVISRGTGQAECACMELCKRHYKPVCGSDG
EFYENHCEVHRAACLKRQKITIVHNEDCFFKGDNCKTTEYSKMKKMLLDLQNQKYIMQEN
ENPNGDDLSRKKLLVDQMFKYFDADSNGLIDINELTQVIKQEELDKDLSGCSLYDLLKYD
DWNADKHLALEEFYRTFQVIHLSLPEDQKLSVTAATVGQSAVLSCAIQGALRPPIIWKRN
NIILNNLDLEDINDFGDDGSLYITKVTTTHMGNYTCYADGYEHVYQTHIFQVNVPPVIRV
YPESQAREPGVTASLRCHAEGIPDPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRY
EDTGAYTCIARNEAGVDEDISSLFVEDSARKTLVNILWREEGLGIGNMFYVFYEDGIKVI
QPIECEFQRHIKPSEKLLGFQDEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVL
IVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGTMEKTSPTLQVITLASGNVPHHT
IHTQPVGKQFDRVDDFFIPTTTLIITHMRFGFILHKDEAALQKIDLETMSYIKTINLVDY
KCVPRSLAYTHLGGYYFVGCKPDSTGAVPPQLVVDSVTDSVIGFNSDVTGTPYVSPDGHY
LVSINDVKGLVRVQYITIRGEIQDAFDIHTNLHISDLAFQPSFTEAHQYNIYGSSSTQTD
VLFVELSSGKVKMIKSLKEPLKAEEWPWNQKNRQIQDSGLFGQYLMTPSKDSLFILDGRL
NKLNCEITEVEKGNTVVWVGDA
Download sequence
Identical sequences XP_003794754.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]