SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003796203.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003796203.1.62490
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 5.75e-47
Family MIR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 1079-1206
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-18
Family SPRY domain 0.041
Further Details:      
 
Domain Number 3 Region: 659-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000259
Family SPRY domain 0.064
Further Details:      
 
Domain Number 4 Region: 438-550
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000589
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 5 Region: 101-185
Classification Level Classification E-value
Superfamily MIR domain 0.00000759
Family MIR domain 0.028
Further Details:      
 
Domain Number 6 Region: 4046-4124
Classification Level Classification E-value
Superfamily EF-hand 0.0000106
Family Calmodulin-like 0.041
Further Details:      
 
Domain Number 7 Region: 2194-2264
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000131
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003796203.1.62490
Sequence length 5032
Comment PREDICTED: ryanodine receptor 1 isoform X2 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPD
LAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSCL
TTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGYVTGGHVLRLFHGHMDECLTISPADSDDQ
RRLVFYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLALTEDQGLVV
VDASKAHTKATSFCFRISKEKLDTAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSNAGLYNQFIKGLDSF
SGKPRGSGPPAGTALPIEGVILSLQDLIVYFEPPSEELQHEEKQSKLRSLRNRQSLFQEE
GMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLD
VLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQYNK
WYFEVMVDEVVPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFEAFNLDGLFFPVV
SFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVG
PSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVNFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMM
SNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVGQGWSYSAVQDIPARRNPRL
VPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVESQSRWDRVRIFRAEKSY
AVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGR
PWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFRDIEIGDGFLPVCSLGPGQVGH
LNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEAVPLEHPHYEVARMD
GTVDTPPCLRLTHRTWGSQNSLVEMIFLRLSLPVQFHQHFRCTAGATPLASPGLQPPAED
EARAAEPDPDYENLRRSAGGWGETEGGKEGTAKEGVPGGTPQAGAEAQPARVENEKDATT
EKNKKRGFLFKAKKVAMMTQPPATPALPRLPRDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWVGWVTPDYHQHDMNFDLSKVRAVTVTMGDEHGNVHSSLKCSNCYMVWGGDFV
SPGQQGRISHSDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAAFVLPTNQNV
IQFELGKQKNIMPLSAAMFLSERKNSAPQCPPRLEMQMLMPVSWSRMPNRFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLQLQRFHSHTLRLYRAVCALGNNRV
AHALCSHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTEE
TRTITLFPSGRSTENGPCHHGLPGVGITTSLRPPHHFSPPCFVAALQAAGVAEAPVRLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVK
QILKLIEPEVFTEEEEEEEEEEEEEDEEEKEADEEEEAQEKEDEEKEEEEEAEGEKEEGL
EEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQENQRSRYGLLMK
AFTMSAAETARRTREFRSPPQEQINMLLHFKDPSNEEDCPLSEELRQDLLDFHQDLLAHC
GIQLEGEEEEPEEETTLGSRLMSLLEKVRLVKKKEEGPEEEPPAEESKPRSLQELVSHTV
VRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSMEDTMSLLECLGQI
RSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMQVMVNVLGGGESKE
IRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASVID
NNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAVFVN
GESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGVRRDRR
REHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVP
LEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKGSMVLFLDRVYGIENQDFLLHVL
DVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSM
LHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLK
LLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAMPC
LCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYT
HEKWAFDKIQNNWSYGENVDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWT
IEKAREGEEEKTEKKKTRKISQSAQTYDAREGYNPQPPDLSGVTLSRELQAMAEQLAENY
HNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELMKFLQMNGYAVTRGLK
DMELDSSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKIL
LPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAP
AVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQV
KGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTKNAY
VEKLRPALGECLARLAAAMPVAFLEPQLNEFNACSVYTTKSPRERAILGLPNSVEEMCPD
IPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPTAGAPPPC
TAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLHSHFIPTIGR
LRKRAAKVVAEEEQLRLEAKAEAQEGEMLVRDEFSVLCRDLYALYPLLIRYVDNNRAQWL
TEPNPNAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKSGGS
DQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLITLAKTRYALKDTDEEV
REFLQNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYHLDQT
EHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMLLESYKATWILTEDHSF
EDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIM
AKSCHLEEGGENAEEGEEEEAEVSFEEKEMEKQRLLYQQARLHNRGAAEMVLQMISACKG
ETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFE
RQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTG
NTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTEY
IQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLL
SLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLI
SKKDFQKAMDSQKQFTGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVLLT
NLSEHVPHDPRLRNFLELAESILEYFRPYLGRIEIMGSSRRIERIYFEISETNRAQWEMP
QVKESKRQFIFDVVNEGGESEKMELFVSFCEDTIFEMQIAAQISEPEGEPETEEDEGASA
GEAGTEGAEEGAEGPEGAASATAAAPGVTARAAAAAGRALSGLSYRSLRRRIRRLRRLTA
REAATAAAALLWAAVTRVGAAGVGAAAGALRLLWGSLFGGGLVEGAKKVTVTELLAGMPD
PTGDEVHGEQPAGPGGETDGEGAGEGAGDTTEGADQEEAVAHEAGPGGADGVVAVSEGGP
FRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGEEELLPEPEPQPEPEPEPEKADA
ENGEKEEVPEPPPEPPKKKAPPPAPPKKEEAWSEFWGELEVQRVKFLNYLSRNFYTLRFL
ALFLAFAINFILLFYKVSDSPPGEDDMEGSATGDLSGAGAGGGSGWGSGAGEEAEGEEDE
NMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLEFDG
LYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIYGRERIAELLGMDL
ASLEITAHNERKPSPPPGLLTWLMSIDVKYQIWKFGVIFTDNSFLYLTWYMVMSLLGHYN
NFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNK
SEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVI
VILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNL
ANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS
Download sequence
Identical sequences XP_003796203.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]