SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003797797.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003797797.1.62490
Domain Number 1 Region: 14-112
Classification Level Classification E-value
Superfamily DNA clamp 0.000000722
Family DNA polymerase processivity factor 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003797797.1.62490
Sequence length 280
Comment PREDICTED: checkpoint protein HUS1 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MKFRGKIVDGACLNHFTRVSNMIAKLAKTCTLRISPDKLNFILSDKLTSGGVSMWCELEQ
ENFFSEFQMEGVSAENNEIYVELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVDLL
SVSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPHPDVSIYLPVLKTMKSVVEKMKNISNHL
VIEANLNGELNLKIETELVCVTTHFKDLGNPSLASENASQDRNPEQMAEVHLDIKKLLQF
LVGQQVNPTKALCNIVRNKMVHFDLLHEDVSLQYFIPALS
Download sequence
Identical sequences H0X7H9
ENSOGAP00000011366 XP_003797797.1.62490 ENSOGAP00000011366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]