SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003799090.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003799090.1.62490
Domain Number 1 Region: 102-427
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.17e-46
Family Gamma-glutamyltranspeptidase-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003799090.1.62490
Sequence length 495
Comment PREDICTED: gamma-glutamyltransferase 6 isoform X1 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MDPTEGPVLYQKLLLWESSLEVEEEEEEEEEREISQPLVPNPWRPQDSSGNKPSGLPGAW
ARLAASLLLLAISGSLAVWQLQTKGGLTGNLGSVAPPPSGHSHSPGVYHHSAIISPAATC
SDLGRELLVAGGNVVDAGVGAALCLAVVHPHATGLGATFWGLFHNSSSGNSTALTSGPAQ
TLASNLALPAALPTLHLIHARFGRLPWPRLLVGPIALAQKGFLVDTALAKALAAQGTEGL
CPLLCHADGTPLGPGARATNPKLAAVLQGAALTPTSDLAGDALLSLLARDLGVEAPSAGP
RPTLEPAMRLPMPQGILFTTPSPSAGPELLAQLETTLVSGAPSPDPCPPFLQTTTTPASS
ILATVDNSGSMLLLISSLNSSFGSGHLSPSTGVLLSNLVPGSATSTWACPLILHGSPDDT
EAEVFGWVASGTPDVARAIACALVSHLAGPQSQTQQEPTESPKACGQGTLLQVSAHAEHA
HVSSVPSGCCPFQGF
Download sequence
Identical sequences H0WZP0
ENSOGAP00000008070 ENSOGAP00000008070 XP_003799090.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]