SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003799568.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003799568.1.62490
Domain Number 1 Region: 467-584
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000785
Family F-box domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003799568.1.62490
Sequence length 601
Comment PREDICTED: F-box only protein 46 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MDRSSLLPFQLWCPRPFGTYSQNQPRAPSATLKPSACPEPGSGAEPDHGPVHSENTPPAL
ATEVPTSQPAPLLSAAAAGDEGRVLLDTWYVIKPGNTKEKVAFFVAHQCGGGSRASSMKV
KGHWGSDSSKAKRRRRCLEPTKAPPDPGGREGPLAPEEGPASVGEDLLSVAEMVALVEQR
AALALQSYPRPPTPAPVVFVSAEQGGPAKGLGSERRSGGGDCSRVAEAVAHFEAQRDNTP
TKGLRKEERPGPGPGEVRIAFRISNGRESRAPEGSLPNGAGGRPGCAYPGSPGPGARAKD
KITCDLYQLISPSRDALPSNVEFLLARADEASEGESPAPARPEDTPPAPPPPPARDCGAS
GFHVDVVVTGVVDECIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQSRGPDGPPEP
PPADSPATAPGPDDAEGTADTSLCRLYRHVSHDFLEIRFKIQRLLEPRQYMLLLPEHVLV
KIFSFLPTRALAALKCTCHHFKGIIEAFGVRATDSRWSRDPLYRDDPCKQCRKRYEKGDV
SLCRWHPKPYHHDLPYGRSYWMCCRRADRETPGCRLGLHDNNWVLPCNGPGGGRAGREEG
R
Download sequence
Identical sequences H0XLM1
XP_003799568.1.62490 ENSOGAP00000017011 ENSOGAP00000017011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]