SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003807933.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003807933.1.60992
Domain Number 1 Region: 274-468
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.00000000418
Further Details:      
 
Domain Number 2 Region: 24-159
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-27
Family SH2 domain 0.0000000867
Further Details:      
 
Domain Number 3 Region: 204-268
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.53e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003807933.1.60992
Sequence length 468
Comment PREDICTED: beta-chimaerin isoform X2 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREF
HGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRF
ESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKT
NVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIA
QGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIRE
IEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGALKLYFRDLP
IPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDN
FMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF
Download sequence
Identical sequences A0A2K5DCU7 A0A2K5RFP7 A0A2K6T0W1 F7E8S7 G3RAD4 H2PMI5 H2R2E9 P52757
ENSPTRP00000043836 gi|4757980|ref|NP_004058.1| ENSPPYP00000019823 ENSPPYP00000019823 ENSGGOP00000012403 ENSCJAP00000015478 ENSP00000222792 NP_004058.1.87134 NP_004058.1.92137 XP_002751486.1.60252 XP_002818142.1.23681 XP_003318423.1.37143 XP_003807933.1.60992 XP_003935216.1.74449 XP_012303192.1.9421 XP_017382558.1.71028 XP_018886686.1.27298 ENSCJAP00000015559 ENSP00000222792 9598.ENSPTRP00000043836 9600.ENSPPYP00000019823 9606.ENSP00000222792 ENSPTRP00000043836 ENSGGOP00000012403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]