SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003812022.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003812022.1.60992
Domain Number 1 Region: 59-119
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000000311
Family ComEA-like 0.042
Further Details:      
 
Domain Number 2 Region: 170-354
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000311
Family Mitochondrial resolvase ydc2 catalytic domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003812022.1.60992
Sequence length 360
Comment PREDICTED: transcription elongation factor, mitochondrial isoform X1 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MSGSVLFTAGERWRCFLTPSRSSLFWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENA
LDKLFSSEQQASILHVLNTASTKELEAFRLLRGRRSINIVEHRENFGPFQNLESLMNVPL
FKYKSTVQVCNSILCPKTGREKRKSPENRFLRKLLKPDIERERLKAVNSIISIVFGTRRI
AWAHLDRKLTVLDWQQSDRWSLMRGIYSSSVYLEEISSIISKMPKADFYVLEKTGLSIQN
SSLFPILLHFHIMEAMLYALLNKTFAQDGQHQVLSMNRNAVGKHFELMIGDSRTSGKELV
KQFLSDSILKADPRVFFPSDKIVHYRQMFLSTELQRVEELYDSLLQAIAFYELAVFDSQP
Download sequence
Identical sequences G3RXU1 H2QCL7
ENSPTRP00000015302 ENSGGOP00000020628 9598.ENSPTRP00000015302 ENSPTRP00000015302 ENSGGOP00000020628 XP_003812022.1.60992 XP_004042019.1.27298 XP_511389.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]