SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003812277.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003812277.1.60992
Domain Number 1 Region: 7-138
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.31e-40
Family Galectin (animal S-lectin) 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003812277.1.60992
Sequence length 142
Comment PREDICTED: galectin-16 isoform X2 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MSFLTVPYKLPVSLSVGSCVIIKGTPIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGR
RVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCHNEYEVKVNGEYIYAFVHRIPPSY
VKMIQVWRDVSLDSVLVNNGRR
Download sequence
Identical sequences C4XV99 C4XVA2
ENSPTRP00000043424 XP_002829258.1.23681 XP_003812277.1.60992 ENSPTRP00000043424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]