SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003813942.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003813942.1.60992
Domain Number 1 Region: 74-159
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.62e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003813942.1.60992
Sequence length 244
Comment PREDICTED: max-like protein X isoform X3 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MTEPGASPEDPWVKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDED
SDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKA
IVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVS
DQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLK
NQLY
Download sequence
Identical sequences K7DK97 Q5R6H5
NP_001127572.1.23681 NP_937847.1.87134 NP_937847.1.92137 XP_003813942.1.60992 XP_511513.2.37143 ENSP00000416627 ENSP00000416627 gi|38201612|ref|NP_937847.1| GO.40222 ENSPPYP00000009428 ENSPPYP00000009428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]