SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003815012.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003815012.1.60992
Domain Number 1 Region: 261-559
Classification Level Classification E-value
Superfamily DNase I-like 3.4e-25
Family DNase I-like 0.027
Further Details:      
 
Domain Number 2 Region: 36-104
Classification Level Classification E-value
Superfamily RuvA domain 2-like 3.71e-22
Family ComEA-like 0.017
Further Details:      
 
Domain Number 3 Region: 134-195
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.45e-18
Family ComEA-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003815012.1.60992
Sequence length 569
Comment PREDICTED: endonuclease/exonuclease/phosphatase family domain-containing protein 1 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MGSTLGCHRSIPRDPSDLSHSRKFSAACNFSNILVNQERLNINTATEEELMTLPGVTRAV
ARSIVEYREYIGGFKKVEDLALVSGVGATKLEQVKFEICVSSKGSSAQHSPSSLRRDLLA
EQQPHHLATAVPLTPRVNINTATPAQLMSVRGLSEKMALSIVDFRREHGPFRSVEDLVRM
DGINAAFLDRIRHQVFAERSRPPSTHTNGGLTFTAKPHPSPTSLSLQSEDLDLPPGGPTQ
IISTRPSVEAFGGTRDGRPVLRLATWNLQGCSVEKANNPGVREVVCMTLLENSIKLLAVQ
ELLDREALEKFCTELNQPTLPNIRKWKGPRGCWKAVVAEKPSNQLQKGAGYAGFLWDAAA
GMELRDAGSQESSPSNGHGKPAGPSPYLGRFKVGSHDLTLVNLHLAALTLLGSENPSKNH
SDGHRLASFAQTLQETLKGEKDVIILGDFGQGPDSNDYDILRKEKFHHLIPAHTFTNIST
KNPQGSKSLDNIWISKSLKKVFTGHWAVVREGLTNPWIPDNWSWGGVASEHCPVLAELYT
EKDWSKKDAPRNGSGVALERSEANIKHER
Download sequence
Identical sequences G3QR97
XP_003815012.1.60992 XP_004045357.1.27298 ENSGGOP00000005140 ENSPTRP00000032600 ENSPTRP00000032600 ENSGGOP00000005140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]