SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003815539.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003815539.1.60992
Domain Number 1 Region: 237-369
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.3e-27
Family FHA domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003815539.1.60992
Sequence length 396
Comment PREDICTED: smad nuclear-interacting protein 1 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MKAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEP
ARPGHRGNRARGVSRSPPKKKNKASGRRSKSPRSKRNRSPHHSTVKVKQEREDHPRRGRE
DRQHREPSEQEHRRARNSDRDRHRGHSHQRRTSNERPGSGQGQGRDRDTQNLQAQEEERE
FYNARRREHRQRNDVGGGGSESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFR
GVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCS
KQHAVFQYRLVEYTRADGTVGRRVKPYIIDLGSGNGTFLNNKRIEPQRYYELKEKDVLKF
GFSSREYVLLHESSDTSEIDRKDDEDEEEEEEVSDS
Download sequence
Identical sequences G3SJR4 H2PYP1
XP_003815539.1.60992 XP_004025530.1.27298 XP_513324.2.37143 ENSPTRP00000000966 9598.ENSPTRP00000000966 ENSGGOP00000028354 ENSGGOP00000028354 ENSPTRP00000000966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]