SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003818850.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003818850.1.60992
Domain Number 1 Region: 71-166
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-24
Family SH2 domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 210-257
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000157
Family SOCS box-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003818850.1.60992
Sequence length 258
Comment PREDICTED: cytokine-inducible SH2-containing protein isoform X2 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAP
TPALPMPKEDAPSDPALPAPPPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDC
LPLPRRMADYLRQYPFQL
Download sequence
Identical sequences Q9NSE2
ENSP00000294173 NP_659508.1.87134 NP_659508.1.92137 XP_003818850.1.60992 HR6374 gi|21614507|ref|NP_659508.1| ENSP00000294173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]