SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003818902.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003818902.1.60992
Domain Number 1 Region: 28-84,205-343,392-438
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.13e-75
Family Inositol polyphosphate kinase (IPK) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003818902.1.60992
Sequence length 441
Comment PREDICTED: inositol hexakisphosphate kinase 1 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKPLISREQRFYE
SLPPEMKEFTPEYKGVVSVCFEGDSDGYINLVAYPYVESETVEQDDTPEREQPRRKHSRR
SLHRSGSGSDHKEEKASLSLETSESSQEAKSPKVELHSHSEVPFQMLDGNSGLSSEKISH
NPWSLRCHKQQLSRMRSESKDRKLYKFLLLENVVHHFKYPCVLDLKMGTRQHGDDASAEK
AARQMRKCEQSTSATLGVRVCGMQVYQLDTGHYLCRNKYYGRGLSIEGFRNALYQYLHNG
LDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYDGKECRAESCLDRRSEMRLKH
LDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVRMIDFAHSTFKGFRDDPTVHDGPDR
GYVFGLENLISIMEQMRDENQ
Download sequence
Identical sequences A0A0D9RQ18 A0A2K5KHZ8 A0A2K5TSD0 A0A2K6ATM6 F7GRE2 G1R5D4 G3R503 H2QMM3
ENSPTRP00000025775 ENSPTRP00000025775 ENSMMUP00000019153 9544.ENSMMUP00000019153 9598.ENSPTRP00000025775 ENSNLEP00000008406 ENSNLEP00000008406 ENSMMUP00000019153 NP_001244692.1.72884 XP_001166017.2.37143 XP_003257126.1.23891 XP_003818902.1.60992 XP_004034206.1.27298 XP_005547207.1.63531 XP_005547208.1.63531 XP_005547209.1.63531 XP_007982453.1.81039 XP_007982454.1.81039 XP_008970500.1.60992 XP_008970501.1.60992 XP_011737660.1.29376 XP_011737661.1.29376 XP_011737662.1.29376 XP_011737663.1.29376 XP_011737664.1.29376 XP_011889123.1.92194 XP_011889124.1.92194 XP_011889125.1.92194 XP_011889127.1.92194 XP_011889128.1.92194 XP_014986280.1.72884 XP_014986281.1.72884 XP_014986282.1.72884 XP_015301399.1.63531 XP_015301400.1.63531 XP_016796601.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]