SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003821017.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003821017.1.60992
Domain Number 1 Region: 21-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-40
Family Pentraxin (pentaxin) 0.00000000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003821017.1.60992
Sequence length 223
Comment PREDICTED: serum amyloid P-component [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MNKLLLWISVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYS
DLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKATSKVMEKFPAPVHICVSWESS
SGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWD
SVLPPENILSAYQGTPLPANILDWRALNYEIRGYVIIKPLVWV
Download sequence
Identical sequences H2Q0D0
ENSPTRP00000002570 ENSPTRP00000002570 9598.ENSPTRP00000002570 XP_003821017.1.60992 XP_513916.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]