SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003823450.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003823450.1.60992
Domain Number 1 Region: 31-330
Classification Level Classification E-value
Superfamily L domain-like 1.63e-47
Family Ngr ectodomain-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003823450.1.60992
Sequence length 338
Comment PREDICTED: lumican [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKS
VPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKK
LHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAF
KGLKSLEYLDLSFNQIAKLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNE
LADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDVKSFCKILGP
LSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
Download sequence
Identical sequences H2Q6L3
ENSPTRP00000008987 ENSGGOP00000022526 ENSGGOP00000022526 9598.ENSPTRP00000008987 XP_003823450.1.60992 XP_509260.3.37143 ENSPTRP00000008987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]