SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003823484.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003823484.1.60992
Domain Number 1 Region: 65-280
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.33e-53
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 287-328
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000157
Family SOCS box-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003823484.1.60992
Sequence length 329
Comment PREDICTED: ankyrin repeat and SOCS box protein 5 isoform X1 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MSVLEENRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYG
VTQGQGSWADRSPLHEAASQGRLLALRTLLSQGYNVNAVTLDHVTPLHEACLGDHVACAR
TLLEAGANVNAITIDGVTPLFNACSQGSPSCAELLLEYGAKAQLESCLPSPTHEAASKGH
HECLDILISWGIDVDQEIPHLGTPLYVACMSQQFHCIWKLLYAGADVQKGKYWDTPLHAA
AQQSSTEIVNLLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC
IRSYIGKPRLHLIPQLQLPTLLKNFLQYR
Download sequence
Identical sequences H2QQG5 Q5HYF3 Q8WWX0
ENSP00000296525 ENSPTRP00000028506 NP_543150.1.87134 NP_543150.1.92137 XP_003823484.1.60992 XP_005262816.1.92137 XP_009446875.1.37143 ENSPTRP00000028506 gi|18254476|ref|NP_543150.1| 9598.ENSPTRP00000028506 9606.ENSP00000296525 ENSP00000296525 ENSP00000296525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]