SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003824845.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_003824845.1.60992
Domain Number - Region: 276-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000158
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 246-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000404
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 214-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000816
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 181-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00109
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 310-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003824845.1.60992
Sequence length 379
Comment PREDICTED: wnt inhibitory factor 1 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSE
GKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN
VPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILQTPQNAIFFKTCQQA
ECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVN
CDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGY
QGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYGASLIHALRPAGAQLRQHT
PSLKKAEERRDPPESNYIW
Download sequence
Identical sequences H2Q6E5
ENSPTRP00000008803 ENSPTRP00000008803 XP_001163469.1.37143 XP_003824845.1.60992 9598.ENSPTRP00000008803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]