SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003825639.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003825639.1.60992
Domain Number 1 Region: 6-92
Classification Level Classification E-value
Superfamily t-snare proteins 9.42e-28
Family t-snare proteins 0.00000407
Further Details:      
 
Domain Number 2 Region: 125-184
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000126
Family SNARE fusion complex 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003825639.1.60992
Sequence length 217
Comment PREDICTED: vesicle transport through interaction with t-SNAREs homolog 1A isoform X2 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVR
EIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLD
NTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRI
LTGMLRRIIQNRILLVILGIIVVITILMAITFSVRRH
Download sequence
Identical sequences A0A2I2ZMC7 H2RC26 Q96AJ9
ENSP00000376792 NP_660207.2.87134 NP_660207.2.92137 XP_001147118.1.37143 XP_003825639.1.60992 XP_004050158.1.27298 ENSGGOP00000010302 ENSGGOP00000010302 ENSP00000376792 ENSP00000376792 ENSPTRP00000056669 9598.ENSPTRP00000056669 9606.ENSP00000376792 gi|113374156|ref|NP_660207.2| ENSPTRP00000005198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]