SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003825644.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003825644.1.60992
Domain Number 1 Region: 297-555
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.01e-75
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 174-281
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-32
Family Kringle modules 0.0003
Further Details:      
 
Domain Number 3 Region: 73-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000367
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 113-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000198
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003825644.1.60992
Sequence length 560
Comment PREDICTED: hyaluronan-binding protein 2 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MFARMSDLHVLLLMALVGKTAYGFSLMSLLESLDPDWTPDQYDYSYEDYNEEENTSSTLT
HAENPDWYYTDDQTDPCQPNPCEHGGDCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPC
GRGQCLITQSPPHYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPD
QFKGKFCEIGSDDCYVGDGYSYRGKMNRTVNQHACLYWNSHLLLQENYNMFMEDAETHGI
GEHNFCRNPDADEKPWCFIKVTNDKVKWEYCDVSACSAQDVAYPEESPTEPSTKLPGFDS
CGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTVSMPQGHFCGGALIHPCWVLTA
AHCTDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPV
DGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTEAGKGSRQLLDAKVKLIANTLCNSR
QLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGKRPGVY
TQVTKFLNWIKATIKSESGF
Download sequence
Identical sequences H2Q2L0
9598.ENSPTRP00000005209 XP_003825644.1.60992 XP_508042.2.37143 ENSPTRP00000005209 ENSPTRP00000005209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]