SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003830821.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003830821.1.60992
Domain Number 1 Region: 185-335
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-45
Family Dual specificity phosphatase-like 0.00000344
Further Details:      
 
Domain Number 2 Region: 3-160
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.34e-24
Family Cell cycle control phosphatase, catalytic domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003830821.1.60992
Sequence length 394
Comment PREDICTED: dual specificity protein phosphatase 4 [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MVTMEELREMDCSVLKRLMNRDENGGGAGGSGSHGTLGLPSGGKCLLLDCRPFLAHSAGY
IRGSVNVRCNTIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLRE
DSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSATEPLD
LGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFEGHY
QYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKR
VRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAASPSGPLRERGKTPATP
TSQFVFSFPVSVGVHSAPSSLPYLHSPITTSPSC
Download sequence
Identical sequences G1S474 G3QSY8 H2QVZ4
XP_003272976.1.23891 XP_003830821.1.60992 XP_004046895.1.27298 XP_520046.2.37143 ENSPTRP00000034453 ENSNLEP00000020312 ENSPTRP00000034454 ENSNLEP00000020312 9598.ENSPTRP00000034454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]