SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003832905.1.60992 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003832905.1.60992
Domain Number 1 Region: 83-465
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.5e-112
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000000000512
Further Details:      
 
Domain Number 2 Region: 9-64
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000000000000628
Family a tRNA synthase domain 0.0000798
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003832905.1.60992
Sequence length 471
Comment PREDICTED: tryptophan--tRNA ligase, cytoplasmic [Pan paniscus]; AA=GCF_000258655.2; RF=representative genome; TAX=9597; STAX=9597; NAME=Pan paniscus; AL=Chromosome; RT=Major
Sequence
MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKA
DCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRI
ERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFT
KWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDY
MGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDR
TDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIF
LTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDY
TSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ
Download sequence
Identical sequences A0A024R6K8 H2R965 P23381 Q5RCX9
ENSPTRP00000052487 gi|47419914|ref|NP_004175.2| gi|47419916|ref|NP_776049.1| ENSP00000347495 ENSP00000376620 ENSP00000451460 ENSPTRP00000052487 ENSP00000339485 NP_004175.2.87134 NP_004175.2.92137 NP_776049.1.87134 NP_776049.1.92137 XP_003832905.1.60992 XP_005268101.1.92137 XP_006720312.1.92137 XP_008956565.1.60992 XP_008956566.1.60992 XP_008956567.1.60992 XP_009426661.1.37143 XP_009426662.1.37143 XP_009426663.1.37143 XP_011535435.1.92137 XP_011535437.1.92137 XP_016781258.1.37143 XP_016781259.1.37143 XP_016781260.1.37143 XP_016877116.1.92137 XP_016877117.1.92137 XP_016877118.1.92137 9598.ENSPTRP00000052487 9606.ENSP00000347495 ENSP00000347495 ENSP00000376620 ENSP00000451460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]