SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003878538.1.65987 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003878538.1.65987
Domain Number 1 Region: 422-475
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000000000907
Family Transcriptional factor domain 0.0022
Further Details:      
 
Domain Number 2 Region: 162-242
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000235
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0048
Further Details:      
 
Domain Number 3 Region: 3-46
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000842
Family PWWP domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003878538.1.65987
Sequence length 476
Comment transcription elongation factor-like protein [Leishmania mexicana MHOM/GT/2001/U1103]; AA=GCF_000234665.1; RF=representative genome; TAX=929439; STAX=5665; NAME=Leishmania mexicana MHOM/GT/2001/U1103; strain=MHOM/GT/2001/U1103; AL=Chromosome; RT=Major
Sequence
MESYCPGDRVWVYIEGDGWWPARVLSDEEVGTRTPGFDLAVQFYAGVEQPATLYELNSHA
DAANICFFETSSEKAVTGNPELEASIRCACADAEANPLKSASAIVGGAKVPAGGSGAAGS
AGAAVVNRAAAKRARDMGDDDTSAYGGGAAASRSVFGYHHLRSDELHELSNKISSAVAAA
DLTAVRAGLCQLDGVDVYLTELEDTKIGVAVGSVLSQPVLKPLWPLARAMISFWARHLPA
ETLAAIRSVQQSQLPVPATRATAAAAAAEPSSPLSKQQPAFPAVPSKSAFASSVSPSAAT
AAGGAGAGAAAGVGSGDVAPTQRKTFYDNVYQLLDSPLSTTRYDDTVIDEVARKLAAEIT
DRDERQMLLLRLREEELSFIRDNLLSGEWTPKKYLDQPNEVFTTKSEKARQEQRIQEKMK
AIEAADNAMLNITSLFKCGRCGKRHCTFYEQQTRSADEPTTKYITCLDCKNIWTQE
Download sequence
Identical sequences E9B4C1
psu|LmxM32.2810 XP_003878538.1.65987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]