SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003878539.1.65987 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003878539.1.65987
Domain Number 1 Region: 5-104
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000265
Family PWWP domain 0.01
Further Details:      
 
Domain Number 2 Region: 319-381
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000000405
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0047
Further Details:      
 
Domain Number 3 Region: 550-590
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000272
Family Transcriptional factor domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003878539.1.65987
Sequence length 594
Comment conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103]; AA=GCF_000234665.1; RF=representative genome; TAX=929439; STAX=5665; NAME=Leishmania mexicana MHOM/GT/2001/U1103; strain=MHOM/GT/2001/U1103; AL=Chromosome; RT=Major
Sequence
MSASTSADYPVNSWVWVKQSGYPWWPAMVLDPAQVGQDPPEGSDVVLLCGPSASATLVFA
SSADVEQLRPYHGAVEDAELIEAGRSDESCAAAIEEMIAALASTDATPGEEGPHTTPSVS
GATEEQGNHAFSGEDDVDWEALAAETEAVMAEPQSAVDQKKHKKDKKHKKRKSNGSSGGD
GHAGGDGPRKTRKDKSSKGHRCYRGGDTYSENEAEVSSGSGDNDSENDEDLFQRRKGASS
SRSAMKKVKYERQSKLEEYDLGPGTLSDYSPRNDLAYYYRKVRNARRTASSTELRTCTQE
LRGFMSRCLSGAATALDVEADILGVLRQLKNVDVTVAQLQETGVGVAIGSLLRFFTPPVV
QLAQAILNYWFHSLPQNTQQQLSAENEVDRCSIETCSDGVAGDNELGRIGVNLFSCFTNE
EINDAPASVDVMALCGAIEDALERRCDADAQMLVLSAFGDTGDTGKALRRLLLEGKIYVE
DIINHAGTLPLLVRTRQRRPPNMQFTVNSPASQDRSDIDSPTSPYGVFSPNDDGSTGSPT
FGSPAGRTTTALYSCPHCGANDAYHSSYSVQAHDSMPDILRCKKCGQTWNVSEQ
Download sequence
Identical sequences E9B4C2
psu|LmxM32.2820 XP_003878539.1.65987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]