SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003924465.1.74449 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003924465.1.74449
Domain Number 1 Region: 213-374,412-474
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-43
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 477-607
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-28
Family cAMP-binding domain 0.0081
Further Details:      
 
Domain Number 3 Region: 37-132
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.34e-17
Family Flavin-binding PAS domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003924465.1.74449
Sequence length 611
Comment PREDICTED: potassium voltage-gated channel subfamily H member 5 isoform X2 [Saimiri boliviensis boliviensis]; AA=GCF_000235385.1; RF=representative genome; TAX=39432; STAX=27679; NAME=Saimiri boliviensis boliviensis; AL=Scaffold; RT=Major
Sequence
MPGGKRGLVAPQNTFLENIVRRSSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQ
KSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEK
VVLFLCTFKDITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTEVVHKHSR
LAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKT
KQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSC
LPYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVA
HWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYV
SSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNR
YHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHL
NRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQD
DEVVAILDHLS
Download sequence
Identical sequences A0A2I2ZYC8 A0A2I3SIC7 A0A2J8WLP0 A0A2K5ETZ4 A0A2K5INB0 A0A2K5RW45 A0A2K6TA93 F7E3G0
ENSP00000395439 gi|27886646|ref|NP_758963.1| ENSCJAP00000035788 NP_758963.1.87134 NP_758963.1.92137 XP_003924465.1.74449 XP_004055322.2.27298 XP_011817350.1.43180 ENSP00000395439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]