SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003928010.1.74449 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003928010.1.74449
Domain Number 1 Region: 38-155
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.06e-38
Family Frizzled cysteine-rich domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 172-283
Classification Level Classification E-value
Superfamily TIMP-like 0.00000000000000283
Family Tissue inhibitor of metalloproteinases, TIMP 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003928010.1.74449
Sequence length 296
Comment PREDICTED: secreted frizzled-related protein 2 [Saimiri boliviensis boliviensis]; AA=GCF_000235385.1; RF=representative genome; TAX=39432; STAX=27679; NAME=Saimiri boliviensis boliviensis; AL=Scaffold; RT=Major
Sequence
MLQGPGSLLLLVLAPHCCLGSAHGLFLFGQPDLSYKRSNCKPIPTNLQLCHGIEYQNMRL
PNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQ
VKDRCAPVMSAFGFPWPDMLDCDRFPQDNDLCIPLASSDHVLPTTTEEAPKVCEACKTKN
DDDNDIMETLCKNDFALKIKVKEITYINGDTKIILETKSKTIYKLNGVSEKDLKKSVLWL
KDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
Download sequence
Identical sequences A0A2K6TBH2 F7E410
XP_002745425.1.60252 XP_003928010.1.74449 ENSCJAP00000003457 ENSCJAP00000047561 ENSCJAP00000003457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]