SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003951834.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003951834.1.37143
Domain Number 1 Region: 49-155
Classification Level Classification E-value
Superfamily L domain-like 8.5e-21
Family Ngr ectodomain-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003951834.1.37143
Sequence length 530
Comment PREDICTED: leucine-rich repeat-containing protein 27 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MEESSSYEVPSVAAADLEEGAGQTRSLPATPSKDVHKGVGGIIFSSSPILDLSESGLCRL
EEVFRIPSLQQLHLQRNALCVIPQDFFQLLPNLTWLDLRCNRIKALPSGIGAHKHLKTLL
LERNPIKMLPVELGSVTTLKALNLRHCPLEFPPQLVVQKGLVAIQRFLRVWAVEHSFPRN
PTSQEAPPVREMTLCDLSSPGLELSGDHASNQGAVNAQDPEGAVMKEKAGFLPPVEKPDL
SELRKSADSSENWPSEEEIRRFWKLRQEIVEHVKADVLGDQLLTRELPPNLKATLNIEKE
LPKPRHVFRRKTASSRSILPDLLSPYQIAIRAKRLEESRAAALRELQEKQALMEQQRREK
RALQEWRERAQRMRKRKEELSKLLPLRRSMVASKTPSATDLIDNGKVPLNPAGKMKPSKE
KSPQASKETRALQERNLEEKIKQHVPQMHEQRRFHGQAPLEEMRKAAEDLEIAAELQDEV
LKPKLGLTLKKDRRRAALTGNLSLGLPAAQPQNTFFNTKYGESGSVRRYQ
Download sequence
Identical sequences H2Q2T1
XP_003951833.1.37143 XP_003951834.1.37143 XP_009457820.1.37143 9598.ENSPTRP00000005408 ENSPTRP00000005408 ENSPTRP00000005408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]