SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003972922.2.43653 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003972922.2.43653
Domain Number 1 Region: 52-523
Classification Level Classification E-value
Superfamily Sema domain 8.5e-127
Family Sema domain 0.0000626
Further Details:      
 
Domain Number 2 Region: 1372-1498,1694-1883
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-51
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 974-1056
Classification Level Classification E-value
Superfamily E set domains 1.23e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.03
Further Details:      
 
Domain Number 4 Region: 1056-1160
Classification Level Classification E-value
Superfamily E set domains 5.47e-16
Family Other IPT/TIG domains 0.038
Further Details:      
 
Domain Number 5 Region: 871-967
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000165
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 6 Region: 526-577
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000536
Family Plexin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003972922.2.43653
Sequence length 1913
Comment PREDICTED: plexin-A4 [Takifugu rubripes]; AA=GCF_000180615.1; RF=representative genome; TAX=31033; STAX=31033; NAME=Takifugu rubripes; AL=Chromosome; RT=Major
Sequence
MMSLTRTWTCFFVCCFLSSLVLPVTSETVLQAAQAHSSQVITASLQEEEYASFRAENSEW
KFNHLAVDYRNGNVYLGAVNRIYKLSPNLEVQVSHETGPDEDNRECYPPRIVQPCSEPLT
LTNNVNKMLLMDYRENRLLACGSLYQGICKLLRLDDLFKLGEPFHKKEHYLSGANESGPV
FGVIVSYGNASPDMLFVATAVDGKPEYFPTISSRKLARNSEEDGMFAYVFHDEFVASMIK
IPSDTFTVIPDFDIYYIYGFASGNFVYFLTLQPEMGSGPTTGSSSTGREQVYTSKIVRLC
KSDPAFNSYVEVPIGCISGNVEYRLLEAAYLSKAGSILARSLDVAPDDDVLFAVFSKGQK
RHLHQSMEDSALCVFSLREINEKIKERLQSCYKGEGTLDLAWLKVKDIPCSSALLTIDDD
FCGLDMNAPLGVSEMVRGKPLYTDAFDKMTSVIAYVYKNHSLVFVGTKSGQLKKIRVDGS
SLALQYETVQAVDNGPILRDMAFSSDFHYLYVMSETQLSRVPVEACGQYSTCSECLGSGD
PHCGWCVLHNTCTRKEKCERSLEPRRFASDIRQCVRLSVHPNNISVSQFSVTLVLEAHNV
PELSAGVNCTFEDLAEMKGLVEGNRIRCSSPAEKEMPRIIVDKGDHQIVQLYLKSKETGL
VFANTSFVFYNCSVHKSCLSCVSSPYQCHWCKYRHDCTHDPRTCSFQEGRVKKPEGCPQL
LPADRILVPVNVVKPITLRAKNLPQPQSGQRGYECLLTIQGNEHRVPALRFNSSSVQCQN
TSYFYDGMDMSSLPVELTVIWNGDFTIDNPTHNKVHLYKCDAQRGSCGLCLKADPLFGCV
WCKGENRCTLKQHCPYPENQWLEHNGINSKCTHPRITKITPLRGPREGGTLVTIRGENLG
LDFREIQGNVKVAEVDCTPIREGYIPAEQIVCEMGKAEKSQYTGNVQVCVGVGECRPEFM
AKSSKYYYFVIPRIINLKPSRGPVSGGTIVNITGSHLDAGSNVSVMFKDQPCTYLRRGGQ
WLTCRTHASLHGYGNVSVSVSIDRAHLQKDLRFEYVEDPTITKIEPEWSIYSGHTPVTVT
GTNLDIIQTPLIRAKYNNHETLNLCQVLSPTSMLCQAPELPISLARQQEVLEKPDEFGFK
LDDVQSLMALNNSNFIYYPNPEFELLSVSGVLELKPGSPIILKGRNFLPPISSGNGKLNY
TVLIGEKPCMLTVSETQLLCESPNLTGRHKVLARVGGIEFSPGVVDIMSDSPLSSTAIIS
IAAAGAMLILVIVVVLIAYKRKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIH
ELTSDLDGAGIPFLDYRTYTMRVLFPGIEEHPVLRDLEVPGYRQEQVEKGLKLFGQLINN
KVYLLCFIRTLEAQRSFSMRDRGNVASLIMTVLQSKLEYATDVLKHLLSDLIDRNLESKN
HPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDSITGEA
RYSLSEDKLIRQQIDYKTLVVNCIHPENEKSPEIQVKVLNCDTISQVKEKILDAIYKNVP
HSHRLKASDMDLEWRQGRGQRMILQDEDITTKIEADWKRLNMLSHYQVPDNAVMALVPKQ
VTAYNSVNNSTVSRTSASKYENMIKYSGSPDSLRSRTPMITPDLESGVKVWHLVKNHEHG
DQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLD
EQADKHNIHDPHVRHTWKSNCLPLRFWVNVIKNPQFVFDIYKSSITDACLSVVAQTFMDS
CSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYSDINKMPAISDQDMNAYLAEQSRMHM
NEFNSMSSLSEIYSYVGKYTEEIVCMLEHDDGARKQRLAIKLEQVVALMTLES
Download sequence
Identical sequences XP_003972922.2.43653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]