SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003982463.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003982463.1.62641
Domain Number 1 Region: 253-405
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-32
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 2 Region: 143-251
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-23
Family Second domain of FERM 0.0013
Further Details:      
 
Domain Number 3 Region: 57-143
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-20
Family First domain of FERM 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003982463.1.62641
Sequence length 1034
Comment PREDICTED: FERM domain-containing protein 4B isoform X2 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MASVFMCGVEDLLFSGSRFVWNLTVSTLRRWYTERLRACHQVLRTWCGLRDVYQMTEGRH
CQVHLLDDRRLELLVQPKLLSRELLDLVASHFNLKEKEYFGITFTDDTGQQNWLQLDHRV
LDHDLPKKPGATILHFAVRFYIESISFLKDKTTVELFFLNAKSCVLKGQIEADSETIFKL
AALVLQEAKGDYTSDENARKDLKTLPAFPTKTLQEHPSLAYCEDRVIEHYLKIKGLTRGQ
AVVQYMKIVEALPTYGVHYYAVKDKQGLPWWLGISYKGIGQYDLQDKVKPRKLFQWKQLE
NLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANPSLIKSIWVMAISQHQFYLDR
KQSKAKIPSARSLDDIAMDLTDTGTPRVSKMVTLEAKSQFIMASNGSLISSGSQDSEVSE
EQKREKILELRKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEYPLNVGEKPPQVRRR
VGAAFKLDDNLLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKKRKQDYTD
AVKKLQDIENAINEYRIRCGKKPSQKATVILPEDIIPSESSSLSDTTTYDDSDAFTLAGQ
RPSSVPHSPRILPPKSLGIERIHFRKSSVNEQFVDTRQSREMLSTHSSPYRTLERRPQGG
RSMPTTPVLTRNAYSSSHLEPESSSQHCRQRSGSLESQSHLLSEMDNDKPFFSLSKSQRS
SSTEILDDGSSYTSQSSTEYYCVTPVAGPYYTTQTLDTRARGRRRSKKQNVSTSNSGSMP
NLAQKDSLRNGVYTKSQEQPSSSYYIAGYPPYAECDLYYSGGYVYENDTEGQYSVNPSYR
SSVHYGYERQTDYSRSFHEDEVDRVPHNPYATLRLPRKPAAKSEHITKNIHKALVAEHLR
GWYQRASGQKDQGHSPQTSFDSDRGSQRCLGFAGLQVPCSPSSRTSSYSSVSSTNASGNW
RTQIAVGLSEYETPAHSSYTSCYGNIYNPLPSPGRQYTEISQLDSTDGNRLEESLKSREQ
RLFWHEDSKPGTLV
Download sequence
Identical sequences M3WAN0
XP_003982463.1.62641 ENSFCAP00000008362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]