SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003982568.2.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003982568.2.62641
Domain Number 1 Region: 216-230,356-617
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-63
Family Nuclear receptor ligand-binding domain 0.0000672
Further Details:      
 
Domain Number 2 Region: 147-229
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.66e-32
Family Nuclear receptor 0.0000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003982568.2.62641
Sequence length 629
Comment PREDICTED: nuclear receptor subfamily 2 group C member 2 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MATNMEGLVQHRVGTQQVAEVPRTQTSRPESPGMTSPSPRIQIISTDSAVASPQRIQIVT
DQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVP
GRIQIVTDSACVERLLGKADVQRPQVVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRK
NLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAAS
TEKIYIRKDLRSPLIATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKA
ETSQGALGTLANVVTSLANLSESLNNGDTSEMQPEDQSASEITRAFDTLAKALNTTDSSS
PPSLADGIDASGGGGIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMPEYLNVHYIC
ESASRLLFLSMHWARSIPAFQALGQDCNTSLVRACWNELFTLGLAQCAQVMSLSTILAAI
VNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSMAKLDIDGYEYAYLKAIVLFSPDHPG
LTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSSNITEELFFTGLI
GNVSIDSIIPYILKMETAEYNGQITGASL
Download sequence
Identical sequences M3W0I7
XP_003982568.2.62641 ENSFCAP00000003265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]