SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003984695.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003984695.1.62641
Domain Number 1 Region: 187-335
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.9e-45
Family Dual specificity phosphatase-like 0.00000344
Further Details:      
 
Domain Number 2 Region: 3-160
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.74e-24
Family Cell cycle control phosphatase, catalytic domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003984695.1.62641
Sequence length 394
Comment PREDICTED: dual specificity protein phosphatase 4 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MVTVEELREMDCSVLKRLMNREENGGGAGGSGSHGAFGLLSGGKCLLLDCRPFLAHSAGY
IRGSVNVRCNTIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLRE
DSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKALATIPPAVPPSTAESLD
VGCGSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFEGHY
QYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKR
VRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAVEAASPSGPLRERGKATPTP
TSQFVFSFPVSVGVHSAPSSLPYLHSPITTSPSC
Download sequence
Identical sequences M3X8R5
XP_003984695.1.62641 9685.ENSFCAP00000007866 ENSFCAP00000007866 ENSFCAP00000023017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]