SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003984982.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003984982.1.62641
Domain Number 1 Region: 96-472
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 5.75e-101
Family Formin homology 2 domain (FH2 domain) 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003984982.1.62641
Sequence length 1130
Comment PREDICTED: FH2 domain-containing protein 1 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MHVMNCVSLVSDKENGNVASAAGFMIGQTPPPPPPPPPPPPPCPYSGEGFLPSPPPPPPP
PLPGMPPVPPPPPGLPPASHMNGYSHLGKKKRMRNFFWKTIPEEQVRGKTNIWTLAARQQ
HHYQIDTKTIEELFGQQEDTTKPSLSRRGGTLNSSFRDPKEEITILDAKRSMNIGIFLKQ
FKKSPQSIVEDIHQGKSEHYGSETLREFLKLLPESEEIKKLKTFSGDVSKLSLADSFLHY
LIQVPNYSLRIEAMVLKKEFLPSCSSLYTDITILRTATKELMLCEELHSILHLVLQAGNI
MNAGGYAGNAVGFKLSSLLKLADTKANKPGMNLLHFVAQEAQKKDAILLNFSEKLHHVQE
AARLSLDNTEAELRSLFIRTRSLRENIQRDGELCQQVEDFLQFAVEKLTELERWKQELQD
EAHTLIDFFCEDKETMKLDECLQIFRDFCVKFNKAVKDNQDRAVQELRQLQRLKEREQKR
RSWAAGELGGFCRSSSENDVELLTKKGTEDLPPFLQPRPVSPSYRPPNARRSRLSLGAFA
DRELLTFLESSTGSPEEPSKFNSLPRSSPRQARPTLAWMEPGGPRAQDPSHARRPQASQS
QEEAPEPPSSWQSQLPVPRPEDPAPLFPRARRSGVGILQKRNSEPMGLAPARSPPLSPLA
LGIKEHELVTGLAQFDLQGPKGPEEVPRLTLNDFSSVEPVSLGDGSMQSLAASHSGLLPV
SSSAPGGLSPALQGNDGSVPDQPSGEALVSVGSSDPESKDPSPLFYISDATDCSLTLDCS
EPGEGGGGDGSLSSGAGETGSQVSSHPPSSPPGEASAPLSGKSEPSCKDALPRDRPAKGK
DATTPKRSSLREASQGTSKAVSARRSQGAAPKPVRTLTASESESMRKVVPISRSSRSSVG
WKRPPGDTPSSPAQQQWSRRSSVRGTSDVSPRRPSTGAVTVPEEPKLARGSSSSGSVRPG
KEHPLQPRGSFKKPSAKPLRNVPRQKPEENKICRSNSESPEEEPKAPPPPSVPRVPPPVP
SFARNTVASSSRSMRTDSPPVAKAPGITRTVSQRQPRPKGSPEDAIPKDSGTLRRASSAR
APKKCPESAGGPSANTETPPKGRGAGERASLRLKNSDPTTLGKILDPLRK
Download sequence
Identical sequences M3X9G8
XP_003984982.1.62641 XP_019684396.1.62641 XP_019684397.1.62641 ENSFCAP00000023270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]